PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa009791
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family Dof
Protein Properties Length: 358aa    MW: 39630.5 Da    PI: 8.0855
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58682575PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.99.6e-3866126262
     zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                ++k+l+cprC+s+ntkfCyynn +++qPr+fCk+C+ryWt+GG++rn+PvG+grrk+k++s
  Lsa009791  66 PDKILPCPRCESMNTKFCYYNNSNVNQPRHFCKSCQRYWTAGGTMRNMPVGAGRRKKKNTS 126
                7899******************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2763123IPR003851Zinc finger, Dof-type
PfamPF027014.2E-3168124IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.62470124IPR003851Zinc finger, Dof-type
PROSITE patternPS01361072108IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MTDPGIILFG KKIGSLETPK ISDSPPFAVA DGGDNGFPTD DSPKTPSIDE DDSPEKHQTT  60
GGLKKPDKIL PCPRCESMNT KFCYYNNSNV NQPRHFCKSC QRYWTAGGTM RNMPVGAGRR  120
KKKNTSSDCR FIISHEAFDV GPQIEFAAEN SDGVYNTSRQ PKVLSFTPNS PICRGKESGD  180
DCSSGTTTVV SSNSVVEKPQ ENNGFHSQVH WIPGTPWSYN PWVPMQIPTG YPPIPFYPPP  240
YWNSVSWLPP ATSAPNYSIL GKHSSDRESI NPIEEPKKQK NSILIPKTLR IDDPDEAAKS  300
SIWATLGIKN ENCSRRDLFK GFEAKGDEKK KQPITEPSLL LQANPAAFSR SLCFQERA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016434796.12e-95PREDICTED: cyclic dof factor 1-like
SwissprotQ8LFV32e-73CDF3_ARATH; Cyclic dof factor 3
TrEMBLA0A103YC941e-179A0A103YC94_CYNCS; Zinc finger, Dof-type
STRINGPGSC0003DMT4000502732e-94(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.18e-66cycling DOF factor 3